Презентация на тему: Иммуногенетика Группы крови

Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Система AB0
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Система Rh (резус-система)
Иммуногенетика Группы крови
положение резус белка резус в мембране эритроцитов
АМИНОКИСЛОТНАЯ ПОСЛЕДОВАТЕЛЬНОСТЬ РЕЗУС-БЕЛКА ЧЕЛОВЕКА
ПОСЛЕДОВАТЕЛЬНОСТЬ НУКЛЕОТИДОВ КОДИРУЮЩЕЙ ЧАСТИ ГЕНА РЕЗУС-БЕЛКА ЧЕЛОВЕКА
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
Иммуногенетика Группы крови
1/77
Средняя оценка: 4.4/5 (всего оценок: 78)
Код скопирован в буфер обмена
Скачать (7786 Кб)
1

Первый слайд презентации: Иммуногенетика Группы крови

Изображение слайда
2

Слайд 2

Изображение слайда
3

Слайд 3

Изображение слайда
4

Слайд 4

Изображение слайда
5

Слайд 5: Система AB0

Изображение слайда
6

Слайд 6

У взрослых людей на эритроцитах могут присутствовать следующие антигены системы АВ0: A¹, A², B

Изображение слайда
7

Слайд 7

Изображение слайда
8

Слайд 8

антигены присутствуют не только на эритроцитах, но в различных концентрациях в клетках большинства тканей организма. Эти антигены являются частью мембран клеток. У 78% людей имеются АВ0 антигены в растворенном виде в различных секреторных жидкостях организма.

Изображение слайда
9

Слайд 9

Антигены АВ0 присутствуют на эритроцитах, лейкоцитах,тромбоцитах, тканевых клетках, жидкостях организма, секретах. Антигены системы АВ0 развиваются на эритроцитах ещё до рождения ребёнка.Обнаружено присутствие А антигена на эритроцитах 37- дневного плода. Но полное созревание антигенов данной системы со всеми им присущими серологическими свойствами происходит только через несколько месяцев после рождения.

Изображение слайда
10

Слайд 10

Антигены А, В по химической природе являются гликолипидами и гликопротеинами. Агглютиногены довольно устойчивы к воздействию различных факторов: высыханию, высокой и низкой температуре, кислотам и щелочам. Поэтому соответствующими методами удаётся определить групповые антигены А и В в высохших пятнах крови, фиксированных формалином тканях и даже у мумий, хранившихся десятки и сотни лет.

Изображение слайда
11

Слайд 11

Аналогично тому, как в эритроцитах имеются групповые антигены А и В, плазма крови может содержать антитела – агглютинины. Агглютинины-это тоже белки, которые находятся в плазме и тканевых жидкостях. Они представляют собой молекулы гамма-глобулина, которые отличаются от других иммуноглобулинов крови способностью специфично соединяться с одноимёнными антигенами крови.

Изображение слайда
12

Слайд 12

В молекуле агглютининов имеются определённые участки – активные центры, которыми они соединяются с антигенными детерминантами агглютиногенов. Каждая молекула антитела имеет не менее двух активных центров.

Изображение слайда
13

Слайд 13

АНТИТЕЛА — это белки (точнее гликопротеины), которые синтезируются под влиянием антигенов и специфически с ними реагируют. Это белки гаммаглобулиновой фракции, поэтому их называют ИММУНОГЛОБУЛИНАМИ (иммунными глобулинами).

Изображение слайда
14

Слайд 14

Изображение слайда
15

Слайд 15

Изображение слайда
16

Слайд 16

Иммуноглобулины обозначаются символом Ig. Синтезируются они В-лимфоцитами, а более точно - ПЛАЗМАТИЧЕСКИМИ КЛЕТКАМИ и содержатся в большом количестве в сыворотке, в межклеточной жидкости и других секретах, обеспечивая гуморальный ответ. Одновременно определенная, но небольшая часть Ig фиксируется на поверхности мембран макрофагов и лимфоцитов, функционируя в качестве рецепторов к антигенам и участвуя, таким образом, не только в гуморальном, но и клеточном иммунном ответе.

Изображение слайда
17

Слайд 17

На В-лимфоцитах Ig встроены в цитоплазматическую мембрану и являются антигенспецифическим рецептором. В данном случае это мембранная форма иммуноглобулинов

Изображение слайда
18

Слайд 18

Изображение слайда
19

Слайд 19

Изображение слайда
20

Слайд 20

Изображение слайда
21

Слайд 21

Изображение слайда
22

Слайд 22

Изображение слайда
23

Слайд 23

Изображение слайда
24

Слайд 24

В молекуле Ig выделяют три фрагмента: два из них идентичны и обладают способностью соединяться с антигеном (точнее с антигенной детерминантой). Поэтому их назвали Fab-фрагментами (fragment antigen binding - фрагмент антигенсвязывающий). Третий фрагмент может кристаллизоваться, и в связи с этим его обозначили как Fc-фрагмент (fragment crystallizable). В Fab-фрагментах располагаются активные центры антител

Изображение слайда
25

Слайд 25

Изображение слайда
26

Слайд 26

Fc-фрагментом антитело связывается с клеточными Fc-рецепторами (FcR), которые находятся на поверхности ряда клеток (макрофагов, моноцитов, лимфоцитов,базофилов и др.). Во всхе V-областях иммуно-глобулинов имеются ГИПЕРВАРИАБЕЛЬНЫЕ УЧАСТКИ с высокой степенью изменчивости аминокислотного состава. На Н -цепи четыре таких участка, а на L -цепи — три

Изображение слайда
27

Слайд 27

Изображение слайда
28

Слайд 28

Четыре цепи между собой связаны дисульфидными связями Вариабельные участки в цепях начинаются от N (концевого участка) и состоят приблизительно из 110 аминокислот. Константный участок Н-цепи в 3 раза длиннее вариабельного и состоит из 3 гомологичных областей, L-цепи – из одной, каждая из которых содержит 3 110 аминокислот. Эти гомологичные участки, длиной 110 аминокислот, свернуты в глобулы и называются доменами.

Изображение слайда
29

Слайд 29

ДОМЕНЫ — это фрагменты цепей Ig, стабилизированные дисульфидными мостиками, состоящие приблизительно из 110 аминокислот (мол. масса 12500). Вторичная структура доменов представляет собой «клубки» (глобулы). Домены, состоящие из вариабельных участков легких и тяжелых цепей,обозначаются соответственно VL и VH.

Изображение слайда
30

Слайд 30

Изображение слайда
31

Слайд 31

АКТИВНЫЙ ЦЕНТР иммуноглобулина (синоним: паратоп ) представляет собой пространство между VH и VL участками и расположен в Fab. Активным центром антител или антидетерминантой, именуют участок молекулы антитела, являющийся структурой, комплементарной (специфичной) детерминантой группе антигена. Именно активными центрами Ig связываются с антигеном. Активный центр антител обладает функциональной автономией, т.е. способен связывать антигенную детерминанту в изолированном виде.

Изображение слайда
32

Слайд 32

Изображение слайда
33

Слайд 33

СПЕЦИФИЧНОСТЬ антител — это способность Ig реагировать только с определенным антигеном. Феномен специфичности основан на наличии активных центров в молекуле антител,вступающих в контакт с соответствующими детерминантами антигена.

Изображение слайда
34

Слайд 34

Изображение слайда
35

Слайд 35

Изображение слайда
36

Слайд 36

Изображение слайда
37

Слайд 37

Изображение слайда
38

Слайд 38

Изображение слайда
39

Слайд 39

Изображение слайда
40

Слайд 40

ВАЛЕНТНОСТЬ антител — это количество активных центров в молекуле антитела. Валентность Ig G равна двум.

Изображение слайда
41

Слайд 41

Изображение слайда
42

Слайд 42

Изображение слайда
43

Слайд 43

Изображение слайда
44

Слайд 44

Изображение слайда
45

Слайд 45

Изображение слайда
46

Слайд 46

С помощью физико-химических и иммунологических методов доказано существование 5 классов Ig с молекулярной массой от 150 000 до 900 000 Д, обозначаемых Ig A, Ig M, Ig G, Ig E, Ig D. Принадлежность иммуноглобулинов к определенному классу определяется типом тяжелых цепей. У IgA тяжелые цепи α (альфа), IgM – μ (мю), IgG – γ (гамма), IgE – ε (эпсилон), IgD – δ (дельта).

Изображение слайда
47

Слайд 47

Изображение слайда
48

Слайд 48

Изображение слайда
49

Слайд 49

Изображение слайда
50

Слайд 50

Антитела против одного и того же антигена могут быть представлены разными классами Ig. При этом выявлена такая закономерность: первыми после иммунизации появляются антитела класса М, затем класса G, и последними иммуноглобулины А и Е. Таким образом, если определяются антитела (к какому-либо инфекционному агенту) класса М, то это свидетельствует о недавнем его инфицировании. Вот почему определение антител классов М и G к одному и тому же возбудителю играет важную диагностическую роль (как к ВИЧ, так и к возбудителю токсоплазмоза,ЦМВ и многим другим патогенам).

Изображение слайда
51

Слайд 51

Изображение слайда
52

Слайд 52

Изображение слайда
53

Слайд 53

Изображение слайда
54

Слайд 54

В молекуле Ig G имеется 12 доменов, по 4 на тяжелых цепях и по 2 на легких.

Изображение слайда
55

Слайд 55

Изображение слайда
56

Слайд 56

Изображение слайда
57

Слайд 57

Изображение слайда
58

Слайд 58

Известно несколько основных групп аллельных генов этой системы: A¹, A², B и 0.

Изображение слайда
59

Слайд 59

Генный локус для этих аллелей находится на длинном плече хромосомы 9.

Изображение слайда
60

Слайд 60

Основными продуктами первых трёх генов — генов A¹, A² и B, но не гена 0 — являются специфические ферменты гликозилтрансферазы, относящиеся к классу трансфераз.

Изображение слайда
61

Слайд 61

Эти гликозилтрансферазы переносят специфические сахара  — N-ацетил-D-галактозамин в случае A¹ и A² типов гликозилтрансфераз, и D-галактозу в случае B-типа гликозилтрансферазы.

Изображение слайда
62

Слайд 62

При этом все три типа гликозилтрансфераз присоединяют переносимый углеводный радикал к альфа-связующему звену коротких олигосахаридных цепочек.

Изображение слайда
63

Слайд 63

Субстратами гликозилирования этими гликозилтрансферазами являются углеводные части гликолипидов и гликопротеидов мембран эритроцитов, и в значительно меньшей степени — гликолипиды и гликопротеиды других тканей и систем организма.

Изображение слайда
64

Слайд 64

Именно специфическое гликозилирование гликозилтрансферазой A или B одного из поверхностных антигенов — агглютиногена — эритроцитов тем или иным сахаром (N-ацетил-D-галактозамином либо D-галактозой) и образует специфический агглютиноген A или B.

Изображение слайда
65

Слайд 65: Система Rh (резус-система)

Изображение слайда
66

Слайд 66

Резус крови — это антиген ( белок ), который находится на поверхности красных кровяных телец (эритроцитов). Он обнаружен в 1940 году Карлом Ландштейнером и А.Вейнером

Изображение слайда
67

Слайд 67: положение резус белка резус в мембране эритроцитов

Изображение слайда
68

Слайд 68: АМИНОКИСЛОТНАЯ ПОСЛЕДОВАТЕЛЬНОСТЬ РЕЗУС-БЕЛКА ЧЕЛОВЕКА

FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA KYFDDQVFWKFPHLAVGF

Изображение слайда
69

Слайд 69: ПОСЛЕДОВАТЕЛЬНОСТЬ НУКЛЕОТИДОВ КОДИРУЮЩЕЙ ЧАСТИ ГЕНА РЕЗУС-БЕЛКА ЧЕЛОВЕКА

1 atgagctcta agtacccgcg gtctgtccgg cgctgcctgc ccctctgggc cctaacactg 61 gaagcagctc tcattctcct cttctatttt tttacccact atgacgcttc cttagaggat 121 caaaaggggc tcgtggcatc ctatcaagtt ggccaagatc tgaccgtgat ggcggccatt 181 ggcttgggct tcctcacctc gagtttccgg agacacagct ggagcagtgt ggccttcaac 241 ctcttcatgc tggcgcttgg tgtgcagtgg gcaatcctgc tggacggctt cctgagccag 301 ttcccttctg ggaaggtggt catcacactg ttcagtattc ggctggccac catgagtgct 361 ttgtcggtgc tgatctcagt ggatgctgtc ttggggaagg tcaacttggc gcagttggtg 421 gtgatggtgc tggtggaggt gacagcttta ggcaacctga ggatggtcat cagtaatatc 481 ttcaacacag actaccacat gaacatgatg cacatctacg tgttcgcagc ctattttggg 541 ctgtctgtgg cctggtgcct gccaaagcct ctacccgagg gaacggagga taaagatcag 601 acagcaacga tacccagttt gtctgccatg ctgggcgccc tcttcttgtg gatgttctgg 661 ccaagtttca actctgctct gctgagaagt ccaatcgaaa ggaagaatgc cgtgttcaac 721 acctactatg ctgtagcagt cagcgtggtg acagccatct cagggtcatc cttggctcac

Изображение слайда
70

Слайд 70

Около 85 % европейцев (99 % индийцев и азиатов) имеют резус и соответственно являются резус-положительными. Остальные же 15 % (7 % у африканцев), у которых его нет, — резус-отрицательный.

Изображение слайда
71

Слайд 71

У большинства людей (85%) имеется ген резус-фактора, но у 15% этот ген отсутствует, отсутствует соответствующий гену нуклеотидный "текст". Если этот ген присутствует, то он определяет у человека синтез резус-белка. Если же его нет, то резус-белок не синтезируется.

Изображение слайда
72

Слайд 72

У человека может встречаться 3 варианта сочетания резус-аллелей

Изображение слайда
73

Слайд 73

Изображение слайда
74

Слайд 74

Человек, у которого 2 аллеля с присутствующим геном, имеет группу крови резус положительную. Если у человека на одной из хромосом ген отсутствует, то белок все равно синтезируется с гена на другой хромосоме; и резус-группа также положительная (рис. в середине). Белок не синтезируется только в том случае, когда ген отсутствует на обоих хромосомах. Только в этом случае группа крови резус-отрицательная

Изображение слайда
75

Слайд 75

резус крови — это сложная система, включающая более 40 антигенов, обозначаемых цифрами, буквами и символами. Чаще всего встречаются резус-антигены типа D (85 %), С (70 %), Е (30 %), е (80 %) — они же и обладают наиболее выраженной антигенностью. Система резус не имеет в норме одноименных агглютининов, но они могут появиться, если резус-отрицательному человеку перелить резус-положительную кровь.

Изображение слайда
76

Слайд 76

Система резус не имеет в норме одноименных агглютининов, но они могут появиться, если резус-отрицательному человеку перелить резус-положительную кровь.

Изображение слайда
77

Последний слайд презентации: Иммуногенетика Группы крови

Резус крови играет важную роль в формировании так называемой гемолитической желтухи новорожденных, вызываемой вследствие резус-конфликта иммунизованной матери и эритроцитов плода.

Изображение слайда