Презентация на тему: BLAST

BLAST
http://www.ncbi.nlm.nih.gov/
BLAST
BLAST
BLAST
BLAST
Форматы файлов, используемых в биоинформатике
BLAST
BLAST
BLAST
BLAST
BLAST
BLAST
Задание на дом
1/14
Средняя оценка: 4.0/5 (всего оценок: 8)
Код скопирован в буфер обмена
Скачать (1407 Кб)
1

Первый слайд презентации: BLAST

Изображение слайда
2

Слайд 2: http://www.ncbi.nlm.nih.gov/

Изображение слайда
3

Слайд 3

Изображение слайда
4

Слайд 4

Step 2: Choose the BLAST program

Изображение слайда
5

Слайд 5

Изображение слайда
6

Слайд 6

Изображение слайда
7

Слайд 7: Форматы файлов, используемых в биоинформатике

FASTA >roa1_drome Rea guano receptor type III >> 0.1 MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHFGNIVDNIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVDVKKALPKNDQQGGGGGRGGPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGNNWGNNRGNDNWGNNSFGGGGGGGGGYGGGNNSWGNNNPWDNGNGGGNFGGGGNNWNGGNDFGGYQQNYGGGPQRGGGNFNNNRMQPYQGGGGFKAGGGNQGNYGNNQGFNNGGNNRRY >roa2_drome Rea guano ligand MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHEKWGNIVDVVVMKDPTSTSTSTSTSTSTSTSTMIDEAQKSRPHKIDGRVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQHLLLLLLLDLLLLDLLLLDLLLFVEFDDYDPVDKVVLQK QHQLNGKMVDVKKALPKNDQQGGGGGRGGPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGNNWGNNRGNDNWGNNSFGGGGGGGGGYGGGNNSWGNNNPWDNGNGGGNFGGGGNNWNGGNDFGGYQQNYGGGPQRGGGNFNNNRMQPYQGGGGFKAGGGNQGNYGNNQGFNNGGNNRRY

Изображение слайда
8

Слайд 8

Изображение слайда
9

Слайд 9

Step 3: choose the database nr = non-redundant (most general database) dbest = database of expressed sequence tags dbsts = database of sequence tag sites gss = genomic survey sequences protein databases nucleotide databases

Изображение слайда
10

Слайд 10

Step 4a: Select optional search parameters Entrez! algorithm organism page 107

Изображение слайда
11

Слайд 11

Scoring matrix Вероятность нахождения последовательностей с таким же скором по случайным причинам Этап 4a: Изменения необязательных параметров Максимальное кол-во выравниваний в выдаче

Изображение слайда
12

Слайд 12

Автоматическая подстройка под параметров под короткие последовательности Для белка стандартно - 3, можно установить 2 для короткого белка, или 4-5 для более точного поиска Этап 4a: Изменения необязательных параметров Автоматическая подстройка под контекстные особенности организмов ( GC состав)

Изображение слайда
13

Слайд 13

Этап 4a: Изменения необязательных параметров Замаскировать low-complexity районы

Изображение слайда
14

Последний слайд презентации: BLAST: Задание на дом

Провести BLAST последовательности Определить гомологов Определить потенциальную функцию белка Дать статистическую оценку найденным гомологам

Изображение слайда